PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G066200.1
Common NamePOPTR_0001s13110g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family ARF
Protein Properties Length: 793aa    MW: 88937.5 Da    PI: 6.9789
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G066200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B372.45.5e-23140241199
                         EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE- CS
                  B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkld 85 
                         f+k lt sd++++g +++ +++a+e+      +++++  ++l+ +d++g++W++++i+r++++r++l++GW+ Fv+a++L +gD ++F   
  Potri.001G066200.1 140 FCKMLTASDTSTHGGFSVLRRHADEClppldmSLQPPA-QELVAKDLHGNEWRFRHIFRGQPRRHLLQSGWSLFVSAKKLVAGDAFIFL-- 227
                         89*****************************9666665.59************************************************.. PP

                         SSSEE..EEEEE-S CS
                  B3  86 grsefelvvkvfrk 99 
                         + +++el+v+v+r+
  Potri.001G066200.1 228 RGETEELRVGVRRA 241
                         3489999****985 PP

2Auxin_resp1188e-39266348183
          Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                         ++ha+st+s+F+v+Y+Pr+s++eF+++++k+++++k+++++GmRfkm+fe e+++e+r+sGtv+gv+++dp +Wp+SkWr+Lk
  Potri.001G066200.1 266 VWHAVSTGSMFTVYYKPRTSPAEFIIPIDKYRESVKINYAIGMRFKMKFEAEEAPEQRFSGTVIGVEEADPKKWPRSKWRCLK 348
                         79*******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.8E-38134255IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.41E-39134269IPR015300DNA-binding pseudobarrel domain
CDDcd100174.13E-20138240No hitNo description
PROSITE profilePS5086311.617140242IPR003340B3 DNA binding domain
SMARTSM010191.5E-21140242IPR003340B3 DNA binding domain
PfamPF023625.1E-21140241IPR003340B3 DNA binding domain
PfamPF065072.6E-35267348IPR010525Auxin response factor
SuperFamilySSF542772.99E-12665745No hitNo description
PROSITE profilePS5174525.128668750IPR000270PB1 domain
PfamPF023091.7E-7713759IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 793 aa     Download sequence    Send to blast
MINGSYSVDN KRNGIARGSS SFPVAGEGSE DALYKELWHA CAGPLVTVPR QGELVYYFPQ  60
GHIEQVEAST NQVADDQQMP AYNLPPKILC RVVNVQLKAE LDTDEVFAQV ILLPVAEQDV  120
DLVEKEDLPP PPARPRVHSF CKMLTASDTS THGGFSVLRR HADECLPPLD MSLQPPAQEL  180
VAKDLHGNEW RFRHIFRGQP RRHLLQSGWS LFVSAKKLVA GDAFIFLRGE TEELRVGVRR  240
ALSQPSNVPS SVMSSHSMHI GILATVWHAV STGSMFTVYY KPRTSPAEFI IPIDKYRESV  300
KINYAIGMRF KMKFEAEEAP EQRFSGTVIG VEEADPKKWP RSKWRCLKVR WDETSPVHRP  360
DRVSPWKIER ALAPSLDPVP GCQSKRHRSN MATSSADSSA PTKKDNEPSR HLQHKEILTL  420
RNTHAGKNYS DSKHNPAQAL FQGKDQTAFD NRKLGPDDKI PQVMHGAKLM NLTTGPGTLH  480
ESYESTHPFF ELNSDDVDRP SKLNETGMFN CHSAPLMYLG HPFNMMASRM EVHVAKDKDI  540
QQQRGSWFSP LPYADNSSHP SGSKPQHLPF QQRNKETSKD GNCKLFGFSL FGNPMAAEPA  600
IIHRHSTEKQ QQQINVASDH LKLLGSEGFL EQAKHSKHVR PEEQGNIFQA SALHSKDVQG  660
MPEGDSTRRC VKVYKQGTAV GRSLDLAKFN GYNELTAELD QIFEFHGELV APNKDWLIVF  720
TDDEGDMMLV GDDPWQEFCS MVRRIFVFTR EEINRMEPRS LNLEAEGNSQ SADQMVDLMG  780
DGTSKHLPAV SP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldw_B1e-1653136917353Auxin response factor 1
4ldw_A1e-1653136917353Auxin response factor 1
4ldv_A1e-1653136917353Auxin response factor 1
4ldx_B1e-1653136917353Auxin response factor 1
4ldx_A1e-1653136917353Auxin response factor 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.117330.0bud
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2084821e-176AC208482.1 Populus trichocarpa clone JGIACSB13-H05, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002299344.20.0hypothetical protein POPTR_0001s13110g
SwissprotQ94JM30.0ARFB_ARATH; Auxin response factor 2
TrEMBLB9GMS50.0B9GMS5_POPTR; Auxin response factor
STRINGPOPTR_0001s13110.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF32813366
Representative plantOGRP5501582
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62000.40.0auxin response factor 2